Biblioteca de diseños

Herramientas de diseño

Recursos

Soluciones Corporativas

Registrarse

Iniciar sesión

7759 Diseños gráficos de deporte para Print On Demand Merch

Descarga diseños de camisetas de deporte y otros gráficos Merch como portadas de libros, carcasas para teléfonos, bolsas de mano y más.

Resultados patrocinados por Shutterstock Logo

Obtén un 15% de descuento con el código: VEXELS15

Diseño de camiseta de fútbol americano.

Listo para imprimir

Cool t-shirt design featuring a sport badge with a football and the quote "Fantasy football legend"

Juego de recorte de jugadores de waterpolo

Cool set of waterpolo players in cut out style

Jugador de baloncesto, juego, cortado Diseño PNG

Jugador de baloncesto, juego, cortado

Colección de silueta de deportes extremos

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de 16 siluetas de jugador de voleibol

This set contains 16 silhouettes of volleyball players hitting the ball in many positions jumping throwing themselves etc

Conjunto de silueta de raquetas de pádel

Amazing sport-themed set that features a series of silhouettes of paddle tennis racquets, all in different shape and sizes

Persona senderismo montañas Diseño PNG

Persona senderismo montañas

Diseño de camiseta de mini gnomos de golf.

Listo para imprimir

Amazing t-shirt design that features gnomes playing mini-golf and the quote "Mini golf squad"

Conjunto de silueta de jugador de hockey

Cool set design that features multiple hockey player silhouettes in different positions

Diseño de camiseta con cita deportiva de pickleball

Listo para imprimir

Cool t-shirt design featuring the quote "Born to play pickleball, forced to work"

Letras múltiples de fútbol americano Diseño PNG

Letras múltiples de fútbol americano

Conjunto de silueta de boxeo

Cool sports themed vector set featuring five silhouettes of boxing player fighting in different poses

Siluetas de jugadores de fútbol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Patinador esqueleto haciendo acrobacias camiseta psd

Listo para imprimir

Cool t-shirt psd featuring a person with a skull for a head skateboarding and the quote "Skate your dreams"

Este está trabajando en el diseño de la camiseta.

Listo para imprimir

Check out this awesome training t-shirt design featuring two hands and the quote 'This one is working out today'

Vista lateral del monopatín recortada Diseño PNG

Vista lateral del monopatín recortada

Diseño de camiseta de pelota deportiva de béisbol punk

Listo para imprimir

Cool t-shirt design featuring a baseball with a punk look and the quote "Baseball college league"

Diseño de camiseta de béisbol estadounidense genial

Listo para imprimir

Great American t-shirt design with the quote "As American as baseball" and a baseball ball with two bats

cuesta abajo - 0 Diseño PNG

cuesta abajo - 0

snowboard - 3 Diseño PNG

snowboard - 3

Mujer, escalada, silueta Diseño PNG

Mujer, escalada, silueta

Diseño de camiseta de senderismo bosque

Listo para imprimir

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Diseño de camiseta de hombre corriendo

Listo para imprimir

Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Diseño de escenografía de jugador de fútbol americano

Amazing character set, one player is sending the pass and the other running for a catch

Diseño de camiseta de evolución de pickleball.

Listo para imprimir

An Evolution t-shirt design featuring a sequence of iconic images capturing the progress of evolution, from single-celled organism to a pickleball player

Juego retro de bolos de pegatinas

Awesome set of retro bowling stickers

Silueta lateral del reformador de Pilates Diseño PNG

Silueta lateral del reformador de Pilates

Ilustración patineta negra Diseño PNG

Ilustración patineta negra

Jugador manteniendo silueta de gol Diseño PNG

Jugador manteniendo silueta de gol

6 insignias de deportes extremos

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Balón de fútbol realista vector

Vector soccer ball

Diseño de camiseta de moto de suciedad grunge

Listo para imprimir

Cool t-shirt design that features a biker riding a motorcycle in front of a US flag

Diseño de camiseta de cita divertida de abuelo de Pickleball

Listo para imprimir

Fun t-shirt design that features the quote "Some grandpas play bingo but badass grandpas play pickleball"

Mujeres haciendo diseño de camiseta de artes marciales jiu jitsu

Listo para imprimir

Awesome t-shirt design featuring two women doing jiu jitsu

Diseño de camiseta deportiva de curling.

Listo para imprimir

Cool t-shirt design that features a curling player and the quote "Curling"

Diseño de camiseta de paddleboard heartbeat

Listo para imprimir

Amazing t-shirt design depicting a man doing paddleboarding between the lines of a heartbeat

Conjunto de diseño de insignia de baloncesto

Awesome badge set design that features eight different basketball badges in the colors orange white and blue

Conjunto de elementos de rugby

Awesome rugby set that features different rugby elements such as a rugby ball a field a goal post and more" all in black and white

Diseño de camiseta de juego de petanca.

Listo para imprimir

Awesome t-shirt design that includes an illustration of a man playing petanque in silhouette style with the word Boule on top of it

Colección de ilustraciones de línea de pilates

Beautiful pilates themed collection featurin multiple line style illustrations of women in different poses

Voleibol de playa Diseño PNG

Voleibol de playa

Fútbol americano Diseño PNG

Fútbol americano

Conjunto de iconos de escuela académica

Set of icons related to academy university school etc

Conjunto de siluetas de jugadores de ráquetbol

Cool silhouette set that features racquetball players in different poses

Signo de cotización de lucha libre de advertencia Diseño PNG

Signo de cotización de lucha libre de advertencia

Diseño de camiseta de tenis T-Rex

Listo para imprimir

Tennis T-Rex T-Shirt Design featuring a Dinosaur playing a Tennis match having some trouble with his short arms! Can be used on t-shirts hoodies mugs posters and any other merchandise

Hombre corriendo con silueta de sombrero Diseño PNG

Hombre corriendo con silueta de sombrero

Fútbol de gran bretaña Diseño PNG

Fútbol de gran bretaña

Conjunto de iconos de trofeos y premios

Are you a winner? Check out this set of several award badges trophy stars and ribbons

Conjunto de 20 siluetas de rugby

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc

de 156

Impulsa tu negociocon la plataforma gráfica líder para merch