Biblioteca de diseños

Herramientas de diseño

Recursos

Soluciones Corporativas

Registrarse

Iniciar sesión

109 Diseños vectoriales de alpinismo para camisetas y Merch

Descarga & compra gráficos vectoriales AI de alpinismo editables para camisetas, carcasas, portadas de libros y otros artículos Merch

Resultados patrocinados por Shutterstock Logo

Obtén un 15% de descuento con el código: VXL15

6 plantillas de logotipos de insignias de montaña

Set of mountain labels or badges

Diseño de camiseta de escalador de bebé colorido

Listo para imprimir

Great t-shirt design featuring a baby climbing a colorful bouldering wall

Uno con el diseño de la camiseta de las montañas

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Conjunto de silueta de personas excursionista y escalador

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Vamos a conseguir un diseño de camiseta realmente alto

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Diseño de camiseta Mountain Love

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Niños jugando paquete de personajes

Character pack featuring 4 kids playing and doing different activities

Diseño de camiseta Stroke Mountain

Cool mountain theme t-shirt design featuring stroke lines looking like mountain over grunge stripes backdrop

Ilustración de Hearbeat de montaña

Mountain Heartbeat design featuring a heartbeat illustration with a mountain in the middle

Forever a mountaineer diseño de camiseta

Listo para imprimir

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

conjunto de iconos de silueta de montaña

Mountain icon set featuring 16 mountain designs in silhouette style

Logotipos de camping retro y emblemas de insignias de senderismo

Diseño de camiseta escalando montañas.

Merchandise design that works great on tshirts posters hats and more

Insignias de etiqueta de senderismo y camping retro

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Diseño de camiseta de montañas aguardando

Cool Black and white T-shirt design with a mountain over the clouds illustration

Diseño de camiseta de escalada de montañas.

T-shirt design featuring the silhouette of someone climbing a mountain

Diseño de camiseta Come Away With Me

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Diseño de camiseta Forever Mountaineer

Listo para imprimir

Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Diseño de camiseta de escalada de Utah

Listo para imprimir

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Diseño de camiseta Mountain Climber Adventure Lifestyle

Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Insignias de camping

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

La aventura espera el diseño de la camiseta.

Simple travel t-shirt design featuring mountain peaks over sky with clouds backdrop in hexagon frame with "Adventure awaits" caption

Ilustraciones de montaña invierno

Set of illustrations featuring people doing alpinism and climbing mountains

Diseño de camiseta Senderismo y escalada Mountain Love

Cool T-shirt design with mountain silhouttes and captions of "Hiking & Climbing" on top and "Mountain" and "Love" at the bottom all in different font styles

Diseño de camiseta de objetivo de alta montaña.

T-shirt design featuring the silhouette of someone climbing a mountain

Diseño de plantilla de logotipo de insignia de montaña

Plantilla de logotipo de montaña abstracta

Plantilla de insignia de etiqueta de montaña

Label or badge design featuring a mountain silhouette in tones of green and blue

Diseño de camiseta de silueta de montaña

T-shirt design featuring the silhouette of someone climbing a mountain

Diseño de plantilla de logotipo de montaña abstracta

Conjunto de ilustraciones de camping

Set of two camping illustrations featuring forest and mountain landscapes

Pack ilustraciones camping

Set of two camping illustrations featuring forest and mountain landscapes

Conjunto de ilustración de paisajes al aire libre

Set of two illustrations featuring a forest and icy mountain landscape

Conjunto de plantillas de logotipo de insignia de montaña

Label or badge designs featuring mountain silhouettes and slogans

2 carteles o marcos de ilustración de bosque al aire libre

Set of two camping illustrations featuring forest landscapes

Diseño de logotipo de etiqueta de montaña

Label design featuring a mountain silhouette in green tones

Plantilla de logotipo de etiqueta de montaña

Conjunto de camping ilustrado

Set of two camping illustrations featuring mountain and forest landscapes

Colección de silueta de deportes extremos

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Diseño de plantilla de logotipo de montaña

Diseño de plantilla de logotipo de etiqueta de montaña

Poses De Bombero De Acción

Various vector designs in this set depicting a fireman in action poses

Plantilla de logotipo de montaña hipster

Fondo de fotos de viajes de vacaciones

Background with several photos of landmarks and landscapes around the world placed over a parchment

30 iconos de círculo deportivo

This set has 30 icons of many different sports represented as silhouettes within colored circles

6 insignias de deportes extremos

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Hombre subiendo escaleras secuencia marcos siluetas

Man climbing stairs sequence frames silhouettes

2 carteles o marcos de ilustración de montaña al aire libre

Set of two illustrations featuring forest and mountain landscapes

Fotoperiodista con fotografías de todo el mundo

Female photojournalist with pictures around the world

Ilustración de columpio de parque infantil

Colorful kids playground illustration of play towers with slides and climbing frame

de 3

Impulsa tu negociocon la plataforma gráfica líder para merch