Biblioteca de diseños

Herramientas de diseño

Recursos

Soluciones Corporativas

Registrarse

Iniciar sesión

1679 vectores & gráficos de aventuras para descargar

Descarga gráficos vectoriales editables de aventuras para cualquier proyecto de diseño. En AI, SVG, PNG, JPG y PSD.

Resultados patrocinados por Shutterstock Logo

Obtén un 15% de descuento con el código: VEXELS15

Seeker man illustration

No encontramos ningún aventuras Vectores, pero aquí están todos nuestros aventuras diseños o solicitar diseño aquí

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Arte de videojuegos retro con monstruos espaciales

Playful t-shirt design showcasing vibrant illustrations of space monsters and a heroic character

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño elegante y gratuito de cita de pájaro

Striking and whimsical, this poster design features two birds in flight, symbolizing freedom

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño intrincado de calavera de alce con temática de naturaleza.

Striking and detailed, this t-shirt design features an intricate illustration of a moose skull adorned with foliage and antlers

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño divertido de ciclismo ecuestre con citas motivacionales.

Dynamic and playful, this t-shirt design features a cartoon horse character energetically riding a bicycle

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de cita de senderismo de aventura con montañas

Playful poster design featuring the inspirational phrase 'Hike More, Worry Less

Página para colorear de princesa de fantasía y unicornio Diseño PNG

Playful coloring page featuring a whimsical princess riding a unicorn

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Póster de viaje a la paradisíaca playa de Tulum

Vibrant travel poster design showcasing Tulum's enchanting seaside landscape

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de cita de aventura en vehículos todoterreno

Dynamic poster design featuring a detailed illustration of a rugged off-road vehicle

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de coche de rally con tipografía atrevida.

Dynamic rally car design featuring a classic racing vehicle in motion

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de astronauta de viaje espacial

Bold graphic design featuring an astronaut in a space suit, surrounded by a globe motif

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Ilustración dinámica de un transbordador espacial con temática de exploradores

Bold graphic design featuring a stylized space shuttle, perfect for poster design

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño gráfico con temática de astronauta y una cita motivacional.

Playful poster design featuring a three-dimensional mesh donut shape that symbolizes exploration

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Explora el diseño del globo infinito

Modern and dynamic poster design featuring a prominent globe illustration with continents

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño gráfico de astronauta surfeando

Playful and adventurous, this poster design features an astronaut skillfully surfing a vibrant wave

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño encantador de cita de hoguera

Playful t-shirt design featuring the quote 'Life is better by a bonfire'

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de cita inspiradora sobre el viaje de un astronauta

Playful t-shirt design featuring the quote 'Life is a Journey Not A Destination' prominently displayed

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de gato astronauta

Playful t-shirt design featuring a whimsical illustration of a cat in a space helmet

Edit Online Badge

Editar en línea

Plantilla de diseño para camiseta Diseño de dragón mítico y cita motivacional.

Dynamic poster design featuring a majestic dragon in a powerful pose

Guerrero poderoso con diseño de guitarra eléctrica. Diseño PNG

Dynamic and bold, this illustration features a muscular warrior raising an electric guitar that resembles a weapon

Diseño divertido de dibujos animados de snowboarder Diseño PNG

Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Ilustración artística de figuras sumergidas en el agua. Diseño PNG

Contemporary and evocative, this poster design features a unique depiction of two legs sticking out of the water, surrounded by submerged heads

HyggeRelaxElements - 4 Diseño PNG

HyggeRelaxElements - 4

Silueta de hombre de senderismo Diseño PNG

Silueta de hombre de senderismo

Diseño gráfico de dirigible vintage Diseño PNG

Sleek and minimalist, this design features a vintage airship rendered in a bold dark blue against a light gray background

Paisaje de bosque verde con ciervos

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Senderismo aventura silueta Diseño PNG

Senderismo aventura silueta

Paisaje de invierno con nieve y árboles.

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

CustomizableBlanks_GeometricSanSerif_vinyl - 1 Diseño PNG

CustomizableBlanks_GeometricSanSerif_vinyl - 1

Insignias de etiqueta de senderismo y camping retro

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Insignias de camping

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Diseño de patrón de siluetas de camping

Pattern continuo

Check this great camping tileable pattern design including different camping elements like tents, lamps, wild animals and more! Edit and use this tileable pattern design for your design projects, wallpapers, backgrounds and more

Senderismo aventura montañas ilustración

Adventure illustration featuring a human silhouette doing hiking

Paisaje de bosques de montaña plana

Flat landscape illustration featuring lots of mountains and woods

Crucero de dibujos animados viajando por el mar

Cartoon Cruise traveling on the sea

Diseño colorido de esquí

This beautiful and colorful design show a man skiing making a jump

9 emblemas de viaje

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Trazo de cita de aventura Diseño PNG

Trazo de cita de aventura

Ilustración plana del atardecer del desierto

Flat sunset illustration featuring a desert with cactus

Ilustración de puesta de sol de playa

Flat sunset illustration featuring a beach with palm trees

Ilustración de playa al atardecer

Flat sunset illustration featuring a beach with palm trees

Paisaje de montaña

Illustrated nature landscape featuring mountains trees and clouds

Ilustración de aventura de invierno de coche de viaje por carretera

Amazing illustration that features a car travelling across mountains and trees and the quote "Winter travel"

Colección de silueta de deportes extremos

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Diseño de paisaje de montaña plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Silueta de senderismo Diseño PNG

Silueta de senderismo

Emblema viajero de aventura Diseño PNG

Emblema viajero de aventura

HatDecals-Iconos - 34 Diseño PNG

HatDecals-Iconos - 34

Diseño de ilustración de paisaje de montaña

Flat illustration featuring moutains and their reflection

6 insignias de deportes extremos

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Ilustración de puesta de sol sobre las montañas

Flat illustration featuring the sun going down behind some mountains and forests

de 34

Impulsa tu negociocon la plataforma gráfica líder para merch